Lineage for d3v21c_ (3v21 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882396Family c.52.1.7: Cfr10I/Bse634I [52999] (2 proteins)
    automatically mapped to Pfam PF07832
  6. 2882397Protein Restriction endonuclease Bse634I [69523] (1 species)
  7. 2882398Species Bacillus stearothermophilus [TaxId:1422] [69524] (4 PDB entries)
  8. 2882405Domain d3v21c_: 3v21 C: [195491]
    automated match to d1knvb_
    protein/DNA complex

Details for d3v21c_

PDB Entry: 3v21 (more details), 2.7 Å

PDB Description: Crystal structure of Type IIF restriction endonuclease Bse634I with cognate DNA
PDB Compounds: (C:) Endonuclease Bse634IR

SCOPe Domain Sequences for d3v21c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v21c_ c.52.1.7 (C:) Restriction endonuclease Bse634I {Bacillus stearothermophilus [TaxId: 1422]}
ltnsncveeykengktkirikpfnalielyhhqtptgsikenldklenyvkdvvkakgla
iptsgafsntrgtwfevmiaiqswnyrvkrelndyliikmpnvktfdfrkifdnetrekl
hqleksllthkqqvrlitsnpdlliirqkdlikseynlpinklthenidvaltlfkdieg
kckwdslvagvglktslrpdrrlqlvhegnilkslfahlkmaywnpkaefkyygassepv
skadddalqtaathtivnvnstperavddifsltsfedidkmldqiik

SCOPe Domain Coordinates for d3v21c_:

Click to download the PDB-style file with coordinates for d3v21c_.
(The format of our PDB-style files is described here.)

Timeline for d3v21c_: