Lineage for d3v1na_ (3v1n A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1869745Family c.69.1.10: Carbon-carbon bond hydrolase [53522] (3 proteins)
    closely related to the Proline iminopeptidase-like family
  6. 1869746Protein 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) [53523] (2 species)
  7. 1869747Species Burkholderia xenovorans [TaxId:36873] [159736] (12 PDB entries)
    Uniprot P47229 4-286
  8. 1869750Domain d3v1na_: 3v1n A: [195763]
    automated match to d2og1a_
    complexed with bez, hpk, mla; mutant

Details for d3v1na_

PDB Entry: 3v1n (more details), 1.59 Å

PDB Description: crystal structure of the h265q mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, after exposure to its substrate hopda
PDB Compounds: (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase

SCOPe Domain Sequences for d3v1na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v1na_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]}
ltesstskfvkinekgfsdfnihyneagngetvimlhgggpgaggwsnyyrnvgpfvdag
yrvilkdspgfnksdavvmdeqrglvnaravkglmdaldidrahlvgnsmggatalnfal
eypdrigklilmgpgglgpsmfapmpmegikllfklyaepsyetlkqmlqvflydqslit
eellqgrweaiqrqpehlknflisaqkaplstwdvtarlgeikaktfitwgrddrfvpld
hglkllwniddarlhvfskcgqwaqwehadefnrlvidflrha

SCOPe Domain Coordinates for d3v1na_:

Click to download the PDB-style file with coordinates for d3v1na_.
(The format of our PDB-style files is described here.)

Timeline for d3v1na_: