Lineage for d3uxkd1 (3uxk D:3-132)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2555341Species Pseudomonas putida [TaxId:303] [228629] (7 PDB entries)
  8. 2555349Domain d3uxkd1: 3uxk D:3-132 [233814]
    Other proteins in same PDB: d3uxka2, d3uxkb2, d3uxkc2, d3uxkd2
    automated match to d4hncb1
    complexed with bho, mg

Details for d3uxkd1

PDB Entry: 3uxk (more details), 2.2 Å

PDB Description: P. putida mandelate racemase co-crystallized with the intermediate analogue benzohydroxamate
PDB Compounds: (D:) mandelate racemase

SCOPe Domain Sequences for d3uxkd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uxkd1 d.54.1.0 (D:3-132) automated matches {Pseudomonas putida [TaxId: 303]}
evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl
kqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhetp
lvkllganar

SCOPe Domain Coordinates for d3uxkd1:

Click to download the PDB-style file with coordinates for d3uxkd1.
(The format of our PDB-style files is described here.)

Timeline for d3uxkd1: