Lineage for d3uvhb2 (3uvh B:92-237)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. Protein automated matches [226848] (13 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries)
  8. Domain d3uvhb2: 3uvh B:92-237 [217534]
    Other proteins in same PDB: d3uvha1, d3uvhb1
    automated match to d1k0ma1
    mutant

Details for d3uvhb2

PDB Entry: 3uvh (more details), 1.84 Å

PDB Description: Crystal Structure Analysis of E81M mutant of human CLIC1
PDB Compounds: (B:) chloride intracellular channel protein 1

SCOPe Domain Sequences for d3uvhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uvhb2 a.45.1.1 (B:92-237) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpee
vdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhryls
nayareefastcpddeeielayeqva

SCOPe Domain Coordinates for d3uvhb2 are not available.

Timeline for d3uvhb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3uvhb1
View in 3D
Domains from other chains:
(mouse over for more information)
d3uvha1, d3uvha2