Lineage for d3uryb1 (3ury B:116-207)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2789161Family b.40.2.0: automated matches [227133] (1 protein)
    not a true family
  6. 2789162Protein automated matches [226834] (6 species)
    not a true protein
  7. 2789193Species Staphylococcus aureus [TaxId:93061] [226094] (8 PDB entries)
  8. 2789201Domain d3uryb1: 3ury B:116-207 [265540]
    Other proteins in same PDB: d3urya2, d3uryb2
    automated match to d4rcob1
    complexed with cl

Details for d3uryb1

PDB Entry: 3ury (more details), 1.9 Å

PDB Description: crystal structure of superantigen-like protein, exotoxin from staphylococcus aureus subsp. aureus nctc 8325
PDB Compounds: (B:) Exotoxin

SCOPe Domain Sequences for d3uryb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uryb1 b.40.2.0 (B:116-207) automated matches {Staphylococcus aureus [TaxId: 93061]}
inpkfkdlrayytkpslefkneigiilkkwttirfmnvvpdyfiykialvgkddkkygeg
vhrnvdvfvvleennynlekysvggitksnsk

SCOPe Domain Coordinates for d3uryb1:

Click to download the PDB-style file with coordinates for d3uryb1.
(The format of our PDB-style files is described here.)

Timeline for d3uryb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3uryb2