Lineage for d3ur2a_ (3ur2 A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) 
the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
has transition metal ions bound inside the barrel
Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
automatically mapped to Pfam PF02126Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (5 species) 
Species Brevundimonas diminuta [TaxId:293] [193602] (6 PDB entries) 
Domain d3ur2a_: 3ur2 A: [193603]
automated match to d1p6cb_
complexed with co, edo, imd; mutant
Details for d3ur2a_
PDB Entry: 3ur2 (more details), 2 Å
PDB Description: crystal structure of pte mutant h254g/h257w/l303t/k185r/i274n/a80v
PDB Compounds: (A:) Parathion hydrolaseSCOPe Domain Sequences for d3ur2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ur2a_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Brevundimonas diminuta [TaxId: 293]}
drintvrgpitiseagftlthehicgssagflrawpeffgsrkalvekavrglrraraag
vrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflrei
qygiedtgiragiikvattgkatpfqelvlraaaraslatgvpvtthtaasqrdgeqqaa
ifeseglspsrvcighsddtddlsyltalaargyligldgipwsaiglednasasallgn
rswqtrallikalidqgymkqilvsndwtfgfssyvtnimdvmdrvnpdgmafiplrvip
flrekgvpqetlagitvtnparflspt
SCOPe Domain Coordinates for d3ur2a_:
Click to download the PDB-style file with coordinates for d3ur2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ur2a_:
- d3ur2a_ first appeared in SCOPe 2.02
- d3ur2a_ appears in SCOPe 2.07
View in 3D
