Lineage for d3uqza2 (3uqz A:72-282)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922906Fold c.129: MCP/YpsA-like [102404] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 4321567
  4. 2922907Superfamily c.129.1: MCP/YpsA-like [102405] (6 families) (S)
  5. 2922981Family c.129.1.4: SLOG domain from DNA-Processing proteins [418834] (1 protein)
    Pfam PF02481
  6. 2922982Protein DNA processing protein A (DprA) [419157] (1 species)
  7. 2922983Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [419679] (1 PDB entry)
  8. 2922984Domain d3uqza2: 3uqz A:72-282 [413488]
    Other proteins in same PDB: d3uqza1, d3uqza3, d3uqzb1, d3uqzc1
    complexed with so4

Details for d3uqza2

PDB Entry: 3uqz (more details), 2.7 Å

PDB Description: X-ray structure of DNA processing protein A (DprA) from Streptococcus pneumoniae
PDB Compounds: (A:) DNA processing protein DprA

SCOPe Domain Sequences for d3uqza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uqza2 c.129.1.4 (A:72-282) DNA processing protein A (DprA) {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
psfsilddcypwdlseiydapvllfykgnldllkfpkvavvgsracskqgaksvekviqg
lenelvivsglakgidtaahmaalqnggktiavigtgldvfypkankrlqdyigndhlvl
seygpgeqplkfhfparnriiaglcrgvivaeakmrsgslitcerameegrdvfaipgsi
ldglsdgchhliqegaklvtsgqdvlaefef

SCOPe Domain Coordinates for d3uqza2:

Click to download the PDB-style file with coordinates for d3uqza2.
(The format of our PDB-style files is described here.)

Timeline for d3uqza2:

  • d3uqza2 is new in SCOPe 2.08-stable