| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (60 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:1773] [193333] (3 PDB entries) |
| Domain d3uoiw_: 3uoi w: [193334] automated match to d3bkna_ complexed with hem |
PDB Entry: 3uoi (more details), 1.9 Å
SCOPe Domain Sequences for d3uoiw_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uoiw_ a.25.1.0 (w:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
ekivadeeehidyletqlelmdklgeelysaqcvsrppt
Timeline for d3uoiw_: