Lineage for d3uoia_ (3uoi A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704375Species Mycobacterium tuberculosis [TaxId:1773] [193333] (3 PDB entries)
  8. 2704376Domain d3uoia_: 3uoi A: [201074]
    automated match to d3uoiw_
    complexed with hem

Details for d3uoia_

PDB Entry: 3uoi (more details), 1.9 Å

PDB Description: Mycobacterium tuberculosis bacterioferritin, BfrA
PDB Compounds: (A:) bacterioferritin

SCOPe Domain Sequences for d3uoia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uoia_ a.25.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd
rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll
ekivadeeehidyletqlelmdklgeelysaqcvsrppt

SCOPe Domain Coordinates for d3uoia_:

Click to download the PDB-style file with coordinates for d3uoia_.
(The format of our PDB-style files is described here.)

Timeline for d3uoia_: