| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
| Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins) |
| Protein automated matches [190083] (7 species) not a true protein |
| Species Burkholderia pseudomallei [TaxId:320372] [189833] (3 PDB entries) |
| Domain d3undb_: 3und B: [186348] automated match to d1o60a_ complexed with a5p, edo, kd0, pep |
PDB Entry: 3und (more details), 2.1 Å
SCOPe Domain Sequences for d3undb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3undb_ c.1.10.4 (B:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
pgsmnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasfd
kanrssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpafla
rqtdlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlvv
dmlgfrqmaettggcpvifdvthslqcrdplgdasggrrrqvldlaragiavgiaglfle
ahpdpdrarcdgpsalplhqlegllsqmkaiddlvkrmpaleir
Timeline for d3undb_: