Lineage for d3undb_ (3und B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1342158Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1342981Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)
  6. 1343178Protein automated matches [190083] (7 species)
    not a true protein
  7. 1343182Species Burkholderia pseudomallei [TaxId:320372] [189833] (3 PDB entries)
  8. 1343184Domain d3undb_: 3und B: [186348]
    automated match to d1o60a_
    complexed with a5p, edo, kd0, pep

Details for d3undb_

PDB Entry: 3und (more details), 2.1 Å

PDB Description: Substrate-bound crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from Burkholderia pseudomallei
PDB Compounds: (B:) 2-dehydro-3-deoxyphosphooctonate aldolase 2

SCOPe Domain Sequences for d3undb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3undb_ c.1.10.4 (B:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
pgsmnvaispgvtagnslpfvlfgginvlesldftldvcgeyvavtrklgipfvfkasfd
kanrssihsyrgvgldeglkifaevkarfgvpvitdvheaeqaapvaeiadvlqvpafla
rqtdlvvaiakagkpvnvkkpqfmsptqlkhvvskcgevgndrvmlcergssfgydnlvv
dmlgfrqmaettggcpvifdvthslqcrdplgdasggrrrqvldlaragiavgiaglfle
ahpdpdrarcdgpsalplhqlegllsqmkaiddlvkrmpaleir

SCOPe Domain Coordinates for d3undb_:

Click to download the PDB-style file with coordinates for d3undb_.
(The format of our PDB-style files is described here.)

Timeline for d3undb_: