Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
Protein automated matches [190447] (49 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [256122] (1 PDB entry) |
Domain d3umca_: 3umc A: [250241] automated match to d2no4b_ complexed with cl, na |
PDB Entry: 3umc (more details), 2.15 Å
SCOPe Domain Sequences for d3umca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3umca_ c.108.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} lyfqgmrailfdvfgtlvdwrsslieqfqalerelggtlpcveltdrwrqqykpamdrvr ngqapwqhldqlhrqslealagefglaldeallqritgfwhrlrpwpdtlagmhalkady wlaalsngntalmldvarhaglpwdmllcadlfghykpdpqvylgacrlldlppqevmlc aahnydlkaaralglktafiarpleygpgqsqdlaaeqdwdliasdlldlhrqlaa
Timeline for d3umca_: