Lineage for d3umca_ (3umc A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1883149Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1883150Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1883848Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1883849Protein automated matches [190447] (49 species)
    not a true protein
  7. 1884145Species Pseudomonas aeruginosa [TaxId:287] [256122] (1 PDB entry)
  8. 1884146Domain d3umca_: 3umc A: [250241]
    automated match to d2no4b_
    complexed with cl, na

Details for d3umca_

PDB Entry: 3umc (more details), 2.15 Å

PDB Description: Crystal Structure of the L-2-Haloacid Dehalogenase PA0810
PDB Compounds: (A:) Haloacid dehalogenase

SCOPe Domain Sequences for d3umca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3umca_ c.108.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
lyfqgmrailfdvfgtlvdwrsslieqfqalerelggtlpcveltdrwrqqykpamdrvr
ngqapwqhldqlhrqslealagefglaldeallqritgfwhrlrpwpdtlagmhalkady
wlaalsngntalmldvarhaglpwdmllcadlfghykpdpqvylgacrlldlppqevmlc
aahnydlkaaralglktafiarpleygpgqsqdlaaeqdwdliasdlldlhrqlaa

SCOPe Domain Coordinates for d3umca_:

Click to download the PDB-style file with coordinates for d3umca_.
(The format of our PDB-style files is described here.)

Timeline for d3umca_: