Lineage for d3ul4a_ (3ul4 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1771693Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1771715Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) (S)
  5. 1771831Family b.2.2.0: automated matches [191610] (1 protein)
    not a true family
  6. 1771832Protein automated matches [191113] (6 species)
    not a true protein
  7. 1771860Species Clostridium thermocellum [TaxId:203119] [194259] (4 PDB entries)
  8. 1771868Domain d3ul4a_: 3ul4 A: [194260]
    Other proteins in same PDB: d3ul4b_
    automated match to d1aohb_
    complexed with ca, peg, so4

Details for d3ul4a_

PDB Entry: 3ul4 (more details), 1.95 Å

PDB Description: Crystal structure of Coh-OlpA(Cthe_3080)-Doc918(Cthe_0918) complex: A novel type I Cohesin-Dockerin complex from Clostridium thermocellum ATTC 27405
PDB Compounds: (A:) Cellulosome-anchoring protein

SCOPe Domain Sequences for d3ul4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ul4a_ b.2.2.0 (A:) automated matches {Clostridium thermocellum [TaxId: 203119]}
ntieiiignvkarpgdrievpvslknvpdkgivssdfvieydsklfkvielkagdivenp
sesfsynvvekdeiiavlyleetglgieairtdgvfftivmevskdvkpgispikfesfg
atadndmnemtpklvegkveii

SCOPe Domain Coordinates for d3ul4a_:

Click to download the PDB-style file with coordinates for d3ul4a_.
(The format of our PDB-style files is described here.)

Timeline for d3ul4a_:

1771868
d3ul4a_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d3ul4b_