Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.0: automated matches [191336] (1 protein) not a true family |
Protein automated matches [190197] (23 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267895] (3 PDB entries) |
Domain d3uk7c2: 3uk7 C:191-388 [265525] Other proteins in same PDB: d3uk7c3 automated match to d1oi4a1 |
PDB Entry: 3uk7 (more details), 2.05 Å
SCOPe Domain Sequences for d3uk7c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uk7c2 c.23.16.0 (C:191-388) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} gkitgankrilflcgdymedyevkvpfqslqalgcqvdavcpekkagdrcptaihdfegd qtysekpghtfalttnfddlvsssydalvipggrapeylalnehvlnivkefmnsekpva sichgqqilaaagvlkgrkctaypavklnvvlgggtwlepdpidrcftdgnlvtgaawpg hpefvsqlmallgiqvsf
Timeline for d3uk7c2:
View in 3D Domains from other chains: (mouse over for more information) d3uk7a1, d3uk7a2, d3uk7b1, d3uk7b2 |