Lineage for d3ugib_ (3ugi B:)
- Root: SCOPe 2.05
Class g: Small proteins [56992] (92 folds) 
Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
dimetal(zinc)-bound alpha+beta foldSuperfamily g.49.1: Cysteine-rich domain [57889] (4 families) 
Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins)
Pfam PF00130Protein automated matches [193184] (2 species)
not a true proteinSpecies Mouse (Mus musculus) [TaxId:10090] [193185] (7 PDB entries) 
Domain d3ugib_: 3ugi B: [193186]
automated match to d1ptqa_
complexed with 09u, po4, zn
Details for d3ugib_
PDB Entry: 3ugi (more details), 1.36 Å
PDB Description: structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase c delta
PDB Compounds: (B:) protein kinase c delta typeSCOPe Domain Sequences for d3ugib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ugib_ g.49.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gsrrasvgshrfkvynymsptfcdhcgsllwglvkqglkcedcgmnvhhkcrekvanlce
fivtd
SCOPe Domain Coordinates for d3ugib_:
Click to download the PDB-style file with coordinates for d3ugib_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ugib_:
- d3ugib_ first appeared in SCOPe 2.02
- d3ugib_ appears in SCOPe 2.04
- d3ugib_ is called d3ugib1 in SCOPe 2.06
- d3ugib_ appears in the current release, SCOPe 2.08, called d3ugib1
View in 3D
