Lineage for d3ugba_ (3ugb A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1642804Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1642805Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1642806Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1642814Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1642850Species Human (Homo sapiens), E2 D3 [TaxId:9606] [143054] (3 PDB entries)
    Uniprot P61077 1-147
  8. 1642852Domain d3ugba_: 3ugb A: [195361]
    Other proteins in same PDB: d3ugbb_
    automated match to d1x23a1
    complexed with gol

Details for d3ugba_

PDB Entry: 3ugb (more details), 2.35 Å

PDB Description: UbcH5c~Ubiquitin Conjugate
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 D3

SCOPe Domain Sequences for d3ugba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ugba_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 D3 [TaxId: 9606]}
alkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsisldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrdkynrisrewtqkyam

SCOPe Domain Coordinates for d3ugba_:

Click to download the PDB-style file with coordinates for d3ugba_.
(The format of our PDB-style files is described here.)

Timeline for d3ugba_: