Lineage for d3uf5a_ (3uf5 A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.26: 4-helical cytokines [47265] (1 superfamily)
core: 4 helices; bundle, closed; left-handed twist; 2 crossover connectionsSuperfamily a.26.1: 4-helical cytokines [47266] (4 families) 
there are two different topoisomers of this fold with different entanglements of the two crossover connections
Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) Protein automated matches [190501] (3 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [187941] (5 PDB entries) 
Domain d3uf5a_: 3uf5 A: [194779]
automated match to d3ejja_
complexed with ca
Details for d3uf5a_
PDB Entry: 3uf5 (more details), 2.8 Å
PDB Description: Crystal structure of the mouse Colony-Stimulating Factor 1 (mCSF-1) cytokine
PDB Compounds: (A:) macrophage colony-stimulating factor 1SCOPe Domain Sequences for d3uf5a_:
Sequence, based on SEQRES records: (download)
>d3uf5a_ a.26.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kevsehcshmignghlkvlqqlidsqmetscqiafefvdqeqlddpvcylkkafflvqdi
idetmrfkdntpnanaterlqelsnnlnscftkdyeeqnkacvrtfhetplqllekiknf
fnetknllekdwniftkncnnsfakcs
Sequence, based on observed residues (ATOM records): (download)
>d3uf5a_ a.26.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kevsehcshmignghlkvlqqlidsqmetscqiafefvdqeqlddpvcylkkafflvqdi
idetmrfkdntpnanaterlqelsnnlnscftkdyenkacvrtfhetplqllekiknffn
etknllekdwniftkncnnsfakcs
SCOPe Domain Coordinates for d3uf5a_:
Click to download the PDB-style file with coordinates for d3uf5a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3uf5a_:
- d3uf5a_ first appeared in SCOPe 2.02
- d3uf5a_ appears in SCOPe 2.04
- d3uf5a_ appears in SCOPe 2.06
- d3uf5a_ appears in the current release, SCOPe 2.08
View in 3D
