Lineage for d3ueec_ (3uee C:)
- Root: SCOPe 2.06
Class g: Small proteins [56992] (94 folds) 
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
metal(zinc)-bound alpha+beta foldSuperfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) 
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) 
Protein automated matches [190700] (1 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187840] (41 PDB entries) 
Domain d3ueec_: 3uee C: [195860]
automated match to d1e31b_
complexed with zn; mutant
Details for d3ueec_
PDB Entry: 3uee (more details), 2.61 Å
PDB Description: crystal structure of human survivin k62a mutant bound to n-terminal histone h3
PDB Compounds: (C:) Baculoviral IAP repeat-containing protein 5SCOPe Domain Sequences for d3ueec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ueec_ g.52.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tlppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffcfael
egwepdddpieehkkhssgcaflsvkkqfeeltlgeflkldreraknkiaketnnkkkef
eetakkvrraieqlaamd
SCOPe Domain Coordinates for d3ueec_:
Click to download the PDB-style file with coordinates for d3ueec_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ueec_:
- d3ueec_ first appeared in SCOPe 2.02
- d3ueec_ appears in SCOPe 2.05
- d3ueec_ appears in SCOPe 2.07
- d3ueec_ appears in the current release, SCOPe 2.08
View in 3D
