Lineage for d3u7yl2 (3u7y L:102-210)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2368133Domain d3u7yl2: 3u7y L:102-210 [217219]
    automated match to d1z3gl2
    complexed with bma, cl, flc, man, nag

Details for d3u7yl2

PDB Entry: 3u7y (more details), 2.45 Å

PDB Description: structure of nih45-46 fab in complex with gp120 of 93th057 hiv
PDB Compounds: (L:) NIH45-46 light chain, Ig kappa chain C region

SCOPe Domain Sequences for d3u7yl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u7yl2 b.1.1.0 (L:102-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ikrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvte
qdskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d3u7yl2:

Click to download the PDB-style file with coordinates for d3u7yl2.
(The format of our PDB-style files is described here.)

Timeline for d3u7yl2:

2368133
d3u7yl2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3u7yl1