Lineage for d3u6yc_ (3u6y C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1912692Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 1913007Superfamily d.68.6: AlbA-like [82704] (3 families) (S)
  5. 1913055Family d.68.6.0: automated matches [191549] (1 protein)
    not a true family
  6. 1913056Protein automated matches [190948] (1 species)
    not a true protein
  7. 1913057Species Aeropyrum pernix [TaxId:272557] [188545] (2 PDB entries)
  8. 1913060Domain d3u6yc_: 3u6y C: [195996]
    automated match to d2h9ua_
    protein/DNA complex; complexed with po4

Details for d3u6yc_

PDB Entry: 3u6y (more details), 2 Å

PDB Description: crystal structure of alba2-dna complex
PDB Compounds: (C:) DNA/RNA-binding protein Alba 2

SCOPe Domain Sequences for d3u6yc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u6yc_ d.68.6.0 (C:) automated matches {Aeropyrum pernix [TaxId: 272557]}
macegapevrigrkpvmnyvlailttlmeqgtnqvvvkargrninravdaveivrkrfak
nieikdikidsqeievqtpegqtrtrrvssieiclekag

SCOPe Domain Coordinates for d3u6yc_:

Click to download the PDB-style file with coordinates for d3u6yc_.
(The format of our PDB-style files is described here.)

Timeline for d3u6yc_: