Lineage for d3u53c_ (3u53 C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2211445Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2211446Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2211447Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2211624Protein automated matches [190465] (5 species)
    not a true protein
  7. 2211640Species Human (Homo sapiens) [TaxId:9606] [189707] (17 PDB entries)
  8. 2211671Domain d3u53c_: 3u53 C: [193745]
    automated match to d1xsba_
    complexed with gol, so4

Details for d3u53c_

PDB Entry: 3u53 (more details), 2.71 Å

PDB Description: Crystal structure of human Ap4A hydrolase
PDB Compounds: (C:) Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]

SCOPe Domain Sequences for d3u53c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u53c_ d.113.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
racgliifrrclipkvdnnaieflllqasdgihhwtppkghvepgeddletalretqeea
gieagqltiiegfkrelnyvarnkpktviywlaevkdydveirlshehqayrwlgleeac
qlaqfkemkaalqeghqflcsiea

SCOPe Domain Coordinates for d3u53c_:

Click to download the PDB-style file with coordinates for d3u53c_.
(The format of our PDB-style files is described here.)

Timeline for d3u53c_: