Lineage for d3u0va_ (3u0v A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2152916Species Human (Homo sapiens) [TaxId:9606] [188340] (73 PDB entries)
  8. 2152923Domain d3u0va_: 3u0v A: [233758]
    automated match to d1auoa_

Details for d3u0va_

PDB Entry: 3u0v (more details), 1.72 Å

PDB Description: Crystal Structure Analysis of human LYPLAL1
PDB Compounds: (A:) Lysophospholipase-like protein 1

SCOPe Domain Sequences for d3u0va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u0va_ c.69.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqrcivspagrhsasliflhgsgdsgqglrmwikqvlnqdltfqhikiiyptapprsytp
mkggisnvwfdrfkitndcpehlesidvmcqvltdlideevksgikknriliggfsmggc
mamhlayrnhqdvagvfalssflnkasavyqalqksngvlpelfqchgtadelvlhswae
etnsmlkslgvttkfhsfpnvyhelskteldilklwiltklp

SCOPe Domain Coordinates for d3u0va_:

Click to download the PDB-style file with coordinates for d3u0va_.
(The format of our PDB-style files is described here.)

Timeline for d3u0va_: