Lineage for d3ty0a_ (3ty0 A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
multihelical; 3 layers or orthogonally packed helicesSuperfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) 
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) 
Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48525] (94 PDB entries)
Uniprot P37231 232-505
Domain d3ty0a_: 3ty0 A: [185999]
automated match to d1wm0x_
complexed with 082
Details for d3ty0a_
PDB Entry: 3ty0 (more details), 2 Å
PDB Description: structure of ppargamma ligand binding domain in complex with (r)-5-(3- ((3-(6-methoxybenzo[d]isoxazol-3-yl)-2-oxo-2,3-dihydro-1h- benzo[d]imidazol-1-yl)methyl)phenyl)-5-methyloxazolidine-2,4-dione
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gammaSCOPe Domain Sequences for d3ty0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ty0a_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
gsqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmged
kikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllky
gvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleld
dsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmt
dlrqivtehvqllqvikktetdmslhpllqeiykdly
SCOPe Domain Coordinates for d3ty0a_:
Click to download the PDB-style file with coordinates for d3ty0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ty0a_:
- d3ty0a_ first appeared in SCOPe 2.01
- d3ty0a_ appears in SCOPe 2.04
- d3ty0a_ is called d3ty0a1 in SCOPe 2.06
- d3ty0a_ appears in the current release, SCOPe 2.08, called d3ty0a1
View in 3D
