Lineage for d3tx1a1 (3tx1 A:1-190)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987459Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2987460Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2987703Family d.145.1.0: automated matches [191624] (1 protein)
    not a true family
  6. 2987704Protein automated matches [191143] (12 species)
    not a true protein
  7. 2987712Species Listeria monocytogenes [TaxId:1639] [226225] (1 PDB entry)
  8. 2987713Domain d3tx1a1: 3tx1 A:1-190 [217063]
    Other proteins in same PDB: d3tx1a2
    automated match to d1hska1
    complexed with fad, gol, so4

Details for d3tx1a1

PDB Entry: 3tx1 (more details), 2.69 Å

PDB Description: x-ray crystal structure of listeria monocytogenes egd-e udp-n- acetylenolpyruvylglucosamine reductase (murb)
PDB Compounds: (A:) udp-n-acetylenolpyruvoylglucosamine reductase

SCOPe Domain Sequences for d3tx1a1:

Sequence, based on SEQRES records: (download)

>d3tx1a1 d.145.1.0 (A:1-190) automated matches {Listeria monocytogenes [TaxId: 1639]}
mnnlqtkfphiaiklneplskytytktggaadvfvmpktieeaqevvaychqnkipltil
gngsnliikdggirgvilhldllqtiernntqivamsgaklidtakfalneslsglefac
gipgsiggalhmnagayggeisdvleaatvltqtgelkklkrselkaayrfstiaeknyi
vldatfslal

Sequence, based on observed residues (ATOM records): (download)

>d3tx1a1 d.145.1.0 (A:1-190) automated matches {Listeria monocytogenes [TaxId: 1639]}
mnnlqtkfphiaiklneplskytytktggaadvfvmpktieeaqevvaychqnkipltil
gngsnliikdggirgvilhldllqtiernntqivamsgaklidtakfalneslsglefac
gipgsiggalhmnagayggeisdvleaatvltqtgelkklkrselkyrstiaeknyivld
atfslal

SCOPe Domain Coordinates for d3tx1a1:

Click to download the PDB-style file with coordinates for d3tx1a1.
(The format of our PDB-style files is described here.)

Timeline for d3tx1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tx1a2