Lineage for d3tw8d_ (3tw8 D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2480081Species Human (Homo sapiens) [TaxId:9606] [186862] (202 PDB entries)
  8. 2480170Domain d3tw8d_: 3tw8 D: [217060]
    automated match to d1zbda_

Details for d3tw8d_

PDB Entry: 3tw8 (more details), 2.1 Å

PDB Description: GEF domain of DENND 1B in complex with Rab GTPase Rab35
PDB Compounds: (D:) Ras-related protein Rab-35

SCOPe Domain Sequences for d3tw8d_:

Sequence, based on SEQRES records: (download)

>d3tw8d_ c.37.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dydhlfklliigdsgvgksslllrfadntfsgsyittigvdfkirtveingekvklqiwd
tagqerfrtitstyyrgthgvivvydvtsaesfvnvkrwlheinqncddvcrilvgnknd
dperkvvetedaykfagqmgiqlfetsakenvnveemfncitelvlrakkdnla

Sequence, based on observed residues (ATOM records): (download)

>d3tw8d_ c.37.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dydhlfklliigdsgvgksslllrfadntfgsyittigvdfkirtveingekvklqiwdt
agqerfrtitstyyrgthgvivvydvtsaesfvnvkrwlheinqncddvcrilvgnkndd
perkvvetedaykfagqmgiqlfetsakenvnveemfncitelvlrakkdnla

SCOPe Domain Coordinates for d3tw8d_:

Click to download the PDB-style file with coordinates for d3tw8d_.
(The format of our PDB-style files is described here.)

Timeline for d3tw8d_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3tw8b_