Lineage for d3tura1 (3tur A:150-251)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766049Family b.1.18.24: L,D-transpeptidase immunoglobulin-like domain [418802] (1 protein)
    Pfam PF17964
  6. 2766050Protein L,D-transpeptidase immunoglobulin-like domain [419105] (1 species)
  7. 2766051Species Mycobacterium tuberculosis [TaxId:1773] [419618] (6 PDB entries)
  8. 2766054Domain d3tura1: 3tur A:150-251 [413454]
    Other proteins in same PDB: d3tura2
    complexed with 0jc, 6cl, dgl, pt

Details for d3tura1

PDB Entry: 3tur (more details), 1.72 Å

PDB Description: crystal structure of m. tuberculosis ld-transpeptidase type 2 complexed with a peptidoglycan fragment
PDB Compounds: (A:) Mycobacteria Tuberculosis LD-transpeptidase type 2

SCOPe Domain Sequences for d3tura1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tura1 b.1.18.24 (A:150-251) L,D-transpeptidase immunoglobulin-like domain {Mycobacterium tuberculosis [TaxId: 1773]}
hltmpyvmpgdgevvgvgepvairfdeniadrgaaekaikittnppvegafywlnnrevr
wrpehfwkpgtavdvavntygvdlgegmfgednvqthftigd

SCOPe Domain Coordinates for d3tura1:

Click to download the PDB-style file with coordinates for d3tura1.
(The format of our PDB-style files is described here.)

Timeline for d3tura1:

  • d3tura1 is new in SCOPe 2.08-stable

2766054
d3tura1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3tura2