Lineage for d3tunb2 (3tun B:607-767)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487290Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 1487291Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 1487344Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 1487345Protein automated matches [226872] (7 species)
    not a true protein
  7. 1487372Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226413] (4 PDB entries)
  8. 1487376Domain d3tunb2: 3tun B:607-767 [217036]
    Other proteins in same PDB: d3tunb1
    automated match to d1rqga1
    protein/RNA complex; complexed with c13, dms, gol, met

Details for d3tunb2

PDB Entry: 3tun (more details), 2.55 Å

PDB Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor Chem 1356
PDB Compounds: (B:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d3tunb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tunb2 a.27.1.0 (B:607-767) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrst

SCOPe Domain Coordinates for d3tunb2:

Click to download the PDB-style file with coordinates for d3tunb2.
(The format of our PDB-style files is described here.)

Timeline for d3tunb2: