Lineage for d3tunb1 (3tun B:-4-371,B:386-606)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1359291Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1359292Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1359851Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 1359852Protein automated matches [190459] (31 species)
    not a true protein
  7. 1360000Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188998] (5 PDB entries)
  8. 1360004Domain d3tunb1: 3tun B:-4-371,B:386-606 [217035]
    Other proteins in same PDB: d3tunb2
    automated match to d1rqga2
    protein/RNA complex; complexed with c13, dms, gol, met

Details for d3tunb1

PDB Entry: 3tun (more details), 2.55 Å

PDB Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor Chem 1356
PDB Compounds: (B:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d3tunb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tunb1 c.26.1.0 (B:-4-371,B:386-606) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
gpgsmkvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgq
kvaeaakqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqk
gdiylgryegwysisdesflXpckvslesghvvtwvseenymfrlsafrerllewyhanp
gcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwldaltnyltg
srlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglplpkkiva
hgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdknmiarlng
el

SCOPe Domain Coordinates for d3tunb1:

Click to download the PDB-style file with coordinates for d3tunb1.
(The format of our PDB-style files is described here.)

Timeline for d3tunb1:

1360004
d3tunb1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3tunb2