SCOPe 2.08: Domain d3tuid1: 3tui D:1-240

Lineage for d3tuid1 (3tui D:1-240)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
division into families based on beta-sheet topologies

Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
there are two additional subdomains inserted into the central core that has a RecA-like topology
missing some secondary structures that made up less than one-third of the common domain

Protein automated matches [190723] (8 species)
not a true protein
Species Escherichia coli K-12 [TaxId:83333] [233742] (1 PDB entry)
Domain d3tuid1: 3tui D:1-240 [233743]
Other proteins in same PDB: d3tuia_, d3tuib_, d3tuic2, d3tuic3, d3tuid2, d3tuie_, d3tuif_, d3tuig2, d3tuih2, d3tuih3
automated match to d3dhwc1
complexed with adp

Details for d3tuid1

PDB Entry: 3tui (more details), 2.9 Å

PDB Description: Inward facing conformations of the MetNI methionine ABC transporter: CY5 native crystal form

PDB Compounds: (D:) Methionine import ATP-binding protein metN

SCOPe Domain Sequences for d3tuid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tuid1 c.37.1.12 (D:1-240) automated matches {Escherichia coli K-12 [TaxId: 83333]}
miklsnitkvfhqgtrtiqalnnvslhvpagqiygvigasgagkstlircvnllerpteg
svlvdgqelttlseseltkarrqigmifqhfnllssrtvfgnvalpleldntpkdevkrr
vtellslvglgdkhdsypsnlsggqkqrvaiaralasnpkvllcdqatsaldpattrsil
ellkdinrrlgltillithemdvvkricdcvavisngelieqdtvsevfshpktplaqkf

SCOPe Domain Coordinates for d3tuid1:

Click to download the PDB-style file with coordinates for d3tuid1.
(The format of our PDB-style files is described here.)

Timeline for d3tuid1: