Lineage for d3tuia_ (3tui A:)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.58: MetI-like [161097] (1 superfamily)
    core: 5 transmembrane helices; flattened bundle
  4. Superfamily f.58.1: MetI-like [161098] (1 family) (S)
  5. Family f.58.1.1: MetI-like [161099] (6 proteins)
    Pfam PF00528; Binding-protein-dependent transport system inner membrane component
  6. Protein automated matches [191243] (1 species)
    not a true protein
  7. Species Escherichia coli K-12 [TaxId:83333] [189709] (8 PDB entries)
  8. Domain d3tuia_: 3tui A: [185956]
    Other proteins in same PDB: d3tuic1, d3tuic2, d3tuic3, d3tuid1, d3tuid2, d3tuig1, d3tuig2, d3tuih1, d3tuih2, d3tuih3
    automated match to d3dhwa1
    complexed with adp

Details for d3tuia_

PDB Entry: 3tui (more details), 2.9 Å

PDB Description: Inward facing conformations of the MetNI methionine ABC transporter: CY5 native crystal form
PDB Compounds: (A:) D-methionine transport system permease protein metI

SCOPe Domain Sequences for d3tuia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tuia_ f.58.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
msepmmwllvrgvwetlamtfvsgffgfviglpvgvllyvtrpgqiianaklyrtvsaiv
nifrsipfiillvwmipftrvivgtsiglqaaivpltvgaapfiarmvenalleiptgli
easramgatpmqivrkvllpealpglvnaatitlitlvgysamggavgagglgqigyqyg
yigynatvmntvlvllvilvyliqfagdrivravtr

SCOPe Domain Coordinates for d3tuia_ are not available.

Timeline for d3tuia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3tuib_, d3tuic1, d3tuic2, d3tuic3, d3tuid1, d3tuid2, d3tuie_, d3tuif_, d3tuig1, d3tuig2, d3tuih1, d3tuih2, d3tuih3