Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily) consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation |
Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families) automatically mapped to Pfam PF00632 |
Family d.148.1.1: Hect, E3 ligase catalytic domain [56205] (3 proteins) |
Protein automated matches [227072] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226230] (1 PDB entry) |
Domain d3tuga_: 3tug A: [217034] automated match to d1nd7a_ complexed with cl, unx |
PDB Entry: 3tug (more details), 2.27 Å
SCOPe Domain Sequences for d3tuga_:
Sequence, based on SEQRES records: (download)
>d3tuga_ d.148.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vrdfkakvqyfrfwcqqlampqhikitvtrktlfedsfqqimsfspqdlrrrlwvifpge egldyggvarewffllshevsnpmyclfeyagkdnyclqinpasyinpdhlkyfrfigrf iamalfhgkfidtgfslpfykrilnkpvglkdlesidpefynsliwvkennieecdlemy fsvdkeilgeikshdlkpnggnilvteenkeeyirmvaewrlsrgveeqtqaffegfnei lpqqylqyfdakelevllcgmqeidlndwqrhaiyrryartskqimwfwqfvkeidnekr mrllqfvtgtcrlpvggfadlmgsngpqkfciekvgkenwlprshtcfnrldlppyksye qlkekllfaieet
>d3tuga_ d.148.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vrdfkakvqyfrfwcqqlampqhikitvtrktlfedsfqqimsfspqdlrrrlwvifpge egldyggvarewffllshevsnpmyclfeyayclqinpasyinpdhlkyfrfigrfiama lfhgkfidtgfslpfykrilnkpvglkdlesidpefynsliwvkennyfskeeyirmvae wrlsrgveeqtqaffegfneilpqqylqyfdakelevllcgmqeidlndwqrhaiyrrya rtskqimwfwqfvkeidnekrmrllqfvtgtcrlpvggfadlmgsngpqkfciekvgken wlprshtcfnrldlppyksyeqlkekllfaieet
Timeline for d3tuga_: