SCOPe 2.08: Domain d3ttub2: 3ttu B:598-753

Lineage for d3ttub2 (3ttu B:598-753)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)

conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

Family c.23.16.0: automated matches [191336] (1 protein)
not a true family
Protein automated matches [190197] (23 species)
not a true protein
Species Escherichia coli [TaxId:562] [186939] (7 PDB entries)
Domain d3ttub2: 3ttu B:598-753 [233728]
Other proteins in same PDB: d3ttua1, d3ttub1, d3ttuc1, d3ttud1
automated match to d1p80a1
complexed with hem

Details for d3ttub2

PDB Entry: 3ttu (more details), 1.89 Å

PDB Description: Structure of F413Y/H128N double variant of E. coli KatE

PDB Compounds: (B:) catalase hpii

SCOPe Domain Sequences for d3ttub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ttub2 c.23.16.0 (B:598-753) automated matches {Escherichia coli [TaxId: 562]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

SCOPe Domain Coordinates for d3ttub2:

Click to download the PDB-style file with coordinates for d3ttub2.
(The format of our PDB-style files is described here.)

Timeline for d3ttub2: