| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
| Protein automated matches [190039] (161 species) not a true protein |
| Species Pseudomonas aeruginosa [TaxId:287] [195692] (5 PDB entries) |
| Domain d3ttlb_: 3ttl B: [195693] automated match to d1a99a_ |
PDB Entry: 3ttl (more details), 2.3 Å
SCOPe Domain Sequences for d3ttlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ttlb_ c.94.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
slhiynwtdyiapttlkdftkesgidvsydvfdsnetlegklvsghsgydivvpsnnflg
kqiqagafqkldksklpnwknldpallkqlevsdpgnqyavpylwgtngigynvakvkev
lgdqpidswailfepenmkklakcgvafmdsgdemlpaalnylgldpnthdpkdykkaee
vltkvrpyvsyfhsskyisdlangnicvafgysgdvfqaaaraeeagkgidiqyvipkeg
anlwfdlmaipadakaadnayafidyllrpeviakvsdyvgyanaipgarplmdksvsds
eevyppqavldklyvsavlpakvlrlqtrtwtrik
Timeline for d3ttlb_: