Lineage for d3tsoa_ (3tso A:)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (79 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the restProtein automated matches [190047] (16 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [186768] (113 PDB entries) 
Domain d3tsoa_: 3tso A: [194679]
automated match to d2gzha_
complexed with gnp, gol, mg, po4
Details for d3tsoa_
PDB Entry: 3tso (more details), 1.8 Å
PDB Description: Structure of the cancer associated Rab25 protein in complex with FIP2
PDB Compounds: (A:) Ras-related protein Rab-25SCOPe Domain Sequences for d3tsoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tsoa_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfvfkvvligesgvgktnllsrftrnefshdsrttigvefstrtvmlgtaavkaqiwdta
gleryraitsayyrgavgallvfdltkhqtyavverwlkelydhaeativvmlvgnksdl
sqarevpteearmfaenngllfletsaldstnvelafetvlkeifakvs
SCOPe Domain Coordinates for d3tsoa_:
Click to download the PDB-style file with coordinates for d3tsoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3tsoa_:
- d3tsoa_ first appeared in SCOPe 2.02
- d3tsoa_ appears in SCOPe 2.04
- d3tsoa_ appears in the current release, SCOPe 2.08
View in 3D
