Lineage for d3trjd_ (3trj D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908082Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2908083Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2908303Family c.80.1.0: automated matches [191405] (1 protein)
    not a true family
  6. 2908304Protein automated matches [190547] (18 species)
    not a true protein
  7. 2908367Species Francisella tularensis [TaxId:119856] [193630] (1 PDB entry)
  8. 2908371Domain d3trjd_: 3trj D: [193631]
    automated match to d3bjzd_

Details for d3trjd_

PDB Entry: 3trj (more details), 2.8 Å

PDB Description: structure of a phosphoheptose isomerase from francisella tularensis
PDB Compounds: (D:) Phosphoheptose isomerase

SCOPe Domain Sequences for d3trjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3trjd_ c.80.1.0 (D:) automated matches {Francisella tularensis [TaxId: 119856]}
mtsldkinsyfessiqakietanalppaiaqaakamvsclenggkvlvcgngssgviaqh
ftskllnhfemerpplpaialtgdvatitavgnhygfsqifakqvaalgneddillvitt
sgdsenilsaveeahdlemkvialtggsggalqnmyntddielrvpsdnianiqenhfli
vhclcdiidqk

SCOPe Domain Coordinates for d3trjd_:

Click to download the PDB-style file with coordinates for d3trjd_.
(The format of our PDB-style files is described here.)

Timeline for d3trjd_: