Lineage for d3tr8b_ (3tr8 B:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the restSuperfamily c.55.3: Ribonuclease H-like [53098] (15 families) 
consists of one domain of this fold
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
contains Pfam PF00929
Protein automated matches [190162] (5 species)
not a true protein
Species Coxiella burnetii [TaxId:777] [196134] (1 PDB entry) 
Domain d3tr8b_: 3tr8 B: [196135]
automated match to d2igia_
complexed with act, mg, mn
Details for d3tr8b_
PDB Entry: 3tr8 (more details), 2.5 Å
PDB Description: structure of an oligoribonuclease (orn) from coxiella burnetii
PDB Compounds: (B:) OligoribonucleaseSCOPe Domain Sequences for d3tr8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tr8b_ c.55.3.5 (B:) automated matches {Coxiella burnetii [TaxId: 777]}
snamdfsddnliwldlemtgldperdriieiativtnshldilaegpafaihqpdkllta
mdnwntshhtasgllervknssvdeveaetltlaflekyvsagksplcgnsvcqdrrfls
rymprlnqffhyrhldvttlkilaqrwapqiaaahikesqhlalqdirdsieelryyrah
llnl
SCOPe Domain Coordinates for d3tr8b_:
Click to download the PDB-style file with coordinates for d3tr8b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3tr8b_:
- d3tr8b_ first appeared in SCOPe 2.02
- d3tr8b_ appears in SCOPe 2.04
- d3tr8b_ is called d3tr8b1 in SCOPe 2.06
- d3tr8b_ appears in the current release, SCOPe 2.08, called d3tr8b1
View in 3D
