Lineage for d3tr4a_ (3tr4 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2790734Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2790901Family b.40.5.0: automated matches [191399] (1 protein)
    not a true family
  6. 2790902Protein automated matches [190523] (12 species)
    not a true protein
  7. 2790926Species Coxiella burnetii [TaxId:227377] [189766] (1 PDB entry)
  8. 2790927Domain d3tr4a_: 3tr4 A: [185919]
    automated match to d1mjxa_
    complexed with mg, mn

Details for d3tr4a_

PDB Entry: 3tr4 (more details), 2 Å

PDB Description: structure of an inorganic pyrophosphatase (ppa) from coxiella burnetii
PDB Compounds: (A:) inorganic pyrophosphatase

SCOPe Domain Sequences for d3tr4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tr4a_ b.40.5.0 (A:) automated matches {Coxiella burnetii [TaxId: 227377]}
vsagkgiddfnviieipanggevkyeydkelgfltvdrfmptsmrypcnygfvpstlaqd
gdpldvlvltpvpvqpgvlmrvralgimkmedeagedskvlavpvvkacrayeaiqslkd
issllldaishfferykdlepnkwakvkgwedkeaakkefeasivrfke

SCOPe Domain Coordinates for d3tr4a_:

Click to download the PDB-style file with coordinates for d3tr4a_.
(The format of our PDB-style files is described here.)

Timeline for d3tr4a_: