Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.4: ITPase-like [52972] (4 families) formerly Maf/Ham1; elaborated with additional structures inserted in the common fold |
Family c.51.4.0: automated matches [191335] (1 protein) not a true family |
Protein automated matches [190179] (8 species) not a true protein |
Species Coxiella burnetii [TaxId:227377] [226205] (1 PDB entry) |
Domain d3tqua_: 3tqu A: [216994] automated match to d2e5xa_ complexed with ca, edo |
PDB Entry: 3tqu (more details), 1.9 Å
SCOPe Domain Sequences for d3tqua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tqua_ c.51.4.0 (A:) automated matches {Coxiella burnetii [TaxId: 227377]} mleivlasqnssklaemqellrdleikfipqtefsvpdieetgstfvenaiikarhaakq tglpaladdsgltiaalnsapgvfssryagknatdaeriqkvlealeaaddsdrsasfhc vialmenendpaplichgvwegeiareprgkngfgydpifyvpshqrtaaeldpqeknai shrgqaleqlstvltea
Timeline for d3tqua_: