Lineage for d3tqia1 (3tqi A:5-207)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2859252Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2859253Protein automated matches [190197] (23 species)
    not a true protein
  7. 2859260Species Coxiella burnetii [TaxId:777] [256102] (1 PDB entry)
  8. 2859261Domain d3tqia1: 3tqi A:5-207 [249978]
    Other proteins in same PDB: d3tqia2, d3tqia3, d3tqib2, d3tqib3, d3tqic2, d3tqic3, d3tqid2, d3tqid3
    automated match to d1gpma2

Details for d3tqia1

PDB Entry: 3tqi (more details), 2.84 Å

PDB Description: structure of the gmp synthase (guaa) from coxiella burnetii
PDB Compounds: (A:) GMP synthase [glutamine-hydrolyzing]

SCOPe Domain Sequences for d3tqia1:

Sequence, based on SEQRES records: (download)

>d3tqia1 c.23.16.0 (A:5-207) automated matches {Coxiella burnetii [TaxId: 777]}
ihqhrilildfgsqyaqliarrvreigvycelmpcdideetirdfnphgiilsggpetvt
lshtlrapafifeigcpvlgicygmqtmayqlggkvnrtakaefghaqlrvlnpaflfdg
iedqvspqgeplldvwmshgdivselppgfeatactdnsplaamadfkrrffglqfhpev
thtpqghrilahfvihicqcipn

Sequence, based on observed residues (ATOM records): (download)

>d3tqia1 c.23.16.0 (A:5-207) automated matches {Coxiella burnetii [TaxId: 777]}
ihqhrilildfgsqyaqliarrvreigvycelmpcdideetirdfnphgiilsggpeapa
fifeigcpvlgicygmqtmayqlggkvnefghaqlrvlnpaflfdgiedqvspqgeplld
vwmshgdivselppgfeatactdnsplaamadfkrrffglqfhpevthtpqghrilahfv
ihicqcipn

SCOPe Domain Coordinates for d3tqia1:

Click to download the PDB-style file with coordinates for d3tqia1.
(The format of our PDB-style files is described here.)

Timeline for d3tqia1: