Lineage for d3tqfb_ (3tqf B:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one sideSuperfamily c.91.1: PEP carboxykinase-like [53795] (3 families) 
Family c.91.1.0: automated matches [196141] (1 protein)
not a true familyProtein automated matches [196142] (6 species)
not a true protein
Species Coxiella burnetii [TaxId:777] [196143] (1 PDB entry) 
Domain d3tqfb_: 3tqf B: [196144]
automated match to d1kklc_
complexed with po4
Details for d3tqfb_
PDB Entry: 3tqf (more details), 2.8 Å
PDB Description: structure of the hpr(ser) kinase/phosphatase from coxiella burnetii
PDB Compounds: (B:) Hpr(Ser) kinaseSCOPe Domain Sequences for d3tqfb_:
Sequence, based on SEQRES records: (download)
>d3tqfb_ c.91.1.0 (B:) automated matches {Coxiella burnetii [TaxId: 777]}
kqtwhanflvidkmgvlitgeanigkselslalidrghqlvcddvidlkqennqligscp
svangyilitgigiidvpklfgldavvnqhevhlsislvkpekmpllddplnplyrteii
lginvpkilfpihpgrnlpllietlvrnhrlkmeg
Sequence, based on observed residues (ATOM records): (download)
>d3tqfb_ c.91.1.0 (B:) automated matches {Coxiella burnetii [TaxId: 777]}
kqtwhanflvidkmgvlitgeanigkselslalidrghqlvcddvidlkqennqligscp
svangyilitgigiidvpklfgldavvnqhevhlsislvkpekmpldplnplyrteiilg
invpkilfpihnlpllietlvrnhrlkmeg
SCOPe Domain Coordinates for d3tqfb_:
Click to download the PDB-style file with coordinates for d3tqfb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3tqfb_:
- d3tqfb_ first appeared in SCOPe 2.02
- d3tqfb_ appears in SCOPe 2.04
- d3tqfb_ appears in SCOPe 2.06
- d3tqfb_ appears in the current release, SCOPe 2.08
View in 3D
