![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
![]() | Protein automated matches [190777] (27 species) not a true protein |
![]() | Species Coxiella burnetii [TaxId:777] [189790] (4 PDB entries) |
![]() | Domain d3tq9a_: 3tq9 A: [185906] automated match to d1ddra_ complexed with mtx, ndp |
PDB Entry: 3tq9 (more details), 2.3 Å
SCOPe Domain Sequences for d3tq9a_:
Sequence, based on SEQRES records: (download)
>d3tq9a_ c.71.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]} miitliaamdknrligrnnelpwhlpadlahfksitlgkpivmgrrtfdsigkplphrrn ivitqqknliiegcdifyslddalsaltkepeviiiggarifkealpkadkmiltiinhs fegdvyfpewndkewkitsqikherdeknpypfqflelrr
>d3tq9a_ c.71.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]} miitliaamdknrligrnnelpwhlpadlahfksitlgkpivmgrrtfdsigkplphrrn ivitqqknliiegcdifyslddalsaltkepeviiiggarifkealpkadkmiltiinhs fegdvyfpewndkewkitsqikhfqflelrr
Timeline for d3tq9a_: