Lineage for d3tn5a_ (3tn5 A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) 
the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
has transition metal ions bound inside the barrel
Family c.1.9.0: automated matches [191327] (1 protein)
not a true familyProtein automated matches [190150] (36 species)
not a true protein
Species Geobacillus kaustophilus [TaxId:1462] [189526] (16 PDB entries) 
Domain d3tn5a_: 3tn5 A: [249957]
automated match to d3orwa_
complexed with co, po4; mutant
Details for d3tn5a_
PDB Entry: 3tn5 (more details), 1.75 Å
PDB Description: Crystal structure of GkaP mutant Y99L from Geobacillus kaustophilus HTA426
PDB Compounds: (A:) phosphotriesteraseSCOPe Domain Sequences for d3tn5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tn5a_ c.1.9.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
emvetvcgpvpveqlgktlihehflfgypgfqgdvtrgtfredeslrvaveaaekmkrhg
iqtvvdptpndcgrnpaflrrvaeetglniicatgylyegegappyfqfrrllgtaeddi
ydmfmaeltegiadtgikagviklasskgriteyekmffraaaraqketgaviithtqeg
tmgpeqaayllehgadpkkivighmcgntdpdyhrktlaygvyiafdrfgiqgmvgaptd
eervrtllallrdgyekqimlshdtvnvwlgrpftlpepfaemmknwhvehlfvniipal
knegirdevleqmfignpaalfsa
SCOPe Domain Coordinates for d3tn5a_:
Click to download the PDB-style file with coordinates for d3tn5a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3tn5a_:
- d3tn5a_ first appeared in SCOPe 2.04
- d3tn5a_ appears in SCOPe 2.07
View in 3D
