Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (52 species) not a true protein |
Species Clarkia breweri [TaxId:36903] [226317] (2 PDB entries) |
Domain d3tkyd1: 3tky D:9-122 [216863] Other proteins in same PDB: d3tkya2, d3tkyb2, d3tkyc2, d3tkyd2 automated match to d1kyze1 complexed with n7i, sah |
PDB Entry: 3tky (more details), 2.47 Å
SCOPe Domain Sequences for d3tkyd1:
Sequence, based on SEQRES records: (download)
>d3tkyd1 a.4.5.0 (D:9-122) automated matches {Clarkia breweri [TaxId: 36903]} iqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyispaeiaaq lpttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltkne
>d3tkyd1 a.4.5.0 (D:9-122) automated matches {Clarkia breweri [TaxId: 36903]} iqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksgyispaeiaaqlptt npeapvmldrvlrllasysvvtytlrerlyglapvckfltkne
Timeline for d3tkyd1: