Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (38 species) not a true protein |
Species Clostridium difficile [TaxId:272563] [226453] (4 PDB entries) |
Domain d3tjta2: 3tjt A:121-230 [216848] Other proteins in same PDB: d3tjta1 automated match to d1unfx2 complexed with fe |
PDB Entry: 3tjt (more details), 1.8 Å
SCOPe Domain Sequences for d3tjta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tjta2 d.44.1.0 (A:121-230) automated matches {Clostridium difficile [TaxId: 272563]} ektipseslkeaidrdfgsfekfkqefqksaldvfgsgwawlvatkdgklsimttpnqds pvsknltpiigldvwehayylkyqnrrneyidnwfnvvnwngalenyknl
Timeline for d3tjta2: