Class a: All alpha proteins [46456] (289 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (38 species) not a true protein |
Species Clostridium difficile [TaxId:272563] [226452] (4 PDB entries) |
Domain d3tjta1: 3tjt A:29-120 [216847] Other proteins in same PDB: d3tjta2 automated match to d1unfx1 complexed with fe |
PDB Entry: 3tjt (more details), 1.8 Å
SCOPe Domain Sequences for d3tjta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tjta1 a.2.11.0 (A:29-120) automated matches {Clostridium difficile [TaxId: 272563]} nnkfkvkplpyaydalepyidketmklhhdkhyqayvdklnaalekypelynyslcellq nldslpkdiattvrnnaggaynhkfffdimtp
Timeline for d3tjta1: