Lineage for d3tjta1 (3tjt A:29-120)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
2 helices; antiparallel hairpin, left-handed twistSuperfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) 
automatically mapped to Pfam PF00081
Family a.2.11.0: automated matches [227154] (1 protein)
not a true familyProtein automated matches [226859] (38 species)
not a true protein
Species Clostridium difficile [TaxId:272563] [226452] (4 PDB entries) 
Domain d3tjta1: 3tjt A:29-120 [216847]
Other proteins in same PDB: d3tjta2
automated match to d1unfx1
complexed with fe
Details for d3tjta1
PDB Entry: 3tjt (more details), 1.8 Å
PDB Description: Crystal Structure Analysis of the superoxide dismutase from Clostridium difficile
PDB Compounds: (A:) superoxide dismutaseSCOPe Domain Sequences for d3tjta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tjta1 a.2.11.0 (A:29-120) automated matches {Clostridium difficile [TaxId: 272563]}
nnkfkvkplpyaydalepyidketmklhhdkhyqayvdklnaalekypelynyslcellq
nldslpkdiattvrnnaggaynhkfffdimtp
SCOPe Domain Coordinates for d3tjta1:
Click to download the PDB-style file with coordinates for d3tjta1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3tjta1:
- d3tjta1 first appeared in SCOPe 2.03
- d3tjta1 appears in SCOPe 2.06
- d3tjta1 appears in the current release, SCOPe 2.08
View in 3D
