![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (95 species) not a true protein |
![]() | Species Sphingomonas sp. [TaxId:314266] [267885] (1 PDB entry) |
![]() | Domain d3thua1: 3thu A:1-112 [265380] Other proteins in same PDB: d3thua2, d3thua3, d3thub2, d3thub3, d3thuc2, d3thuc3 automated match to d4il2a1 complexed with cl, gol, mg, unx |
PDB Entry: 3thu (more details), 1.8 Å
SCOPe Domain Sequences for d3thua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3thua1 d.54.1.0 (A:1-112) automated matches {Sphingomonas sp. [TaxId: 314266]} mpkiidakviitcpgrnfvtlkimtdegvyglgdatlngrelavasyltdhvipcligrd ahriedlwqylykgaywrrgpvtmtaiaavdmalwdikgkiaglpvyqllgg
Timeline for d3thua1: