Lineage for d3tf6c_ (3tf6 C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2413761Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2413962Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)
  7. 2413963Species Human (Homo sapiens) [TaxId:9606] [50836] (50 PDB entries)
  8. 2413975Domain d3tf6c_: 3tf6 C: [196179]
    automated match to d1ngla_
    complexed with cl, dbh, eu, gol, so4; mutant

Details for d3tf6c_

PDB Entry: 3tf6 (more details), 2.35 Å

PDB Description: crystal structure of neutrophil gelatinase-associated lipocalin (c87s mutant) in complex with europium and the siderophore analog tren(cam)(1,2-hopo)2
PDB Compounds: (C:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d3tf6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tf6c_ b.60.1.1 (C:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
sdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksy
nvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffk
kvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

SCOPe Domain Coordinates for d3tf6c_:

Click to download the PDB-style file with coordinates for d3tf6c_.
(The format of our PDB-style files is described here.)

Timeline for d3tf6c_: