![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
![]() | Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50836] (50 PDB entries) |
![]() | Domain d3tf6c_: 3tf6 C: [196179] automated match to d1ngla_ complexed with cl, dbh, eu, gol, so4; mutant |
PDB Entry: 3tf6 (more details), 2.35 Å
SCOPe Domain Sequences for d3tf6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tf6c_ b.60.1.1 (C:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]} sdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksy nvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffk kvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid
Timeline for d3tf6c_: