Lineage for d3taua_ (3tau A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) 
division into families based on beta-sheet topologies
Family c.37.1.0: automated matches [191323] (1 protein)
not a true familyProtein automated matches [190123] (156 species)
not a true protein
Species Listeria monocytogenes [TaxId:1639] [196210] (1 PDB entry) 
Domain d3taua_: 3tau A: [200792]
automated match to d3taub_
complexed with na, so4
Details for d3taua_
PDB Entry: 3tau (more details), 2.05 Å
PDB Description: Crystal Structure of a Putative Guanylate Monophosphaste Kinase from Listeria monocytogenes EGD-e
PDB Compounds: (A:) Guanylate kinaseSCOPe Domain Sequences for d3taua_:
Sequence, based on SEQRES records: (download)
>d3taua_ c.37.1.0 (A:) automated matches {Listeria monocytogenes [TaxId: 1639]}
tergllivlsgpsgvgkgtvreavfkdpetsfdysismttrlpregeqdgvdyyfrsrev
feqaikdgkmleyaeyvgnyygtpleyveeklaagvdifleievqgamqvrkampegifi
fltppdlselknriigrgtesmevveermetakkeiemmasydyavvndvvanavqkikg
ivetehlktervihrykkml
Sequence, based on observed residues (ATOM records): (download)
>d3taua_ c.37.1.0 (A:) automated matches {Listeria monocytogenes [TaxId: 1639]}
tergllivlsgpsgvgkgtvreavfkdpetsfdysismttrlpregeqdgvdyyfrsrev
feqaikdgkmleyaeyvgnyygtpleyveeklaagvdifleievqgamqvrkampegifi
fltppdlselknrsmevveermetakkeiemmasydyavvndvvanavqkikgivetehl
ktervihrykkml
SCOPe Domain Coordinates for d3taua_:
Click to download the PDB-style file with coordinates for d3taua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3taua_:
- d3taua_ first appeared in SCOPe 2.03
- d3taua_ appears in SCOPe 2.06
- d3taua_ appears in the current release, SCOPe 2.08
View in 3D
