Lineage for d3ta6b_ (3ta6 B:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) 
Family c.1.1.0: automated matches [191424] (1 protein)
not a true familyProtein automated matches [190605] (21 species)
not a true protein
Species Mycobacterium tuberculosis [TaxId:83332] [189828] (2 PDB entries) 
Domain d3ta6b_: 3ta6 B: [185740]
automated match to d1b9bb_
complexed with flc
Details for d3ta6b_
PDB Entry: 3ta6 (more details), 1.41 Å
PDB Description: Structure of Mycobacterium tuberculosis triosephosphate isomerase
PDB Compounds: (B:) triosephosphate isomeraseSCOPe Domain Sequences for d3ta6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ta6b_ c.1.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
srkpliagnwkmnlnhyeaialvqkiafslpdkyydrvdvavippftdlrsvqtlvdgdk
lrltygaqdlsphdsgaytgdvsgaflaklgcsyvvvghserrtyhneddalvaakaata
lkhgltpivcigehldvreagnhvahnieqlrgslagllaeqigsvviayepvwaigtgr
vasaadaqevcaairkelaslaspriadtvrvlyggsvnaknvgdivaqddvdgglvgga
sldgehfatlaaiaag
SCOPe Domain Coordinates for d3ta6b_:
Click to download the PDB-style file with coordinates for d3ta6b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ta6b_:
- d3ta6b_ first appeared in SCOPe 2.01
- d3ta6b_ appears in SCOPe 2.05
- d3ta6b_ appears in SCOPe 2.07
- d3ta6b_ appears in the current release, SCOPe 2.08
View in 3D
