Class a: All alpha proteins [46456] (290 folds) |
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) duplication: contains multiple CxxCH motifs |
Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins) consists of four heme-binding repeats automatically mapped to Pfam PF02276 |
Protein automated matches [227073] (3 species) not a true protein |
Species Blastochloris viridis [TaxId:1079] [226253] (2 PDB entries) |
Domain d3t6dc_: 3t6d C: [200764] Other proteins in same PDB: d3t6dh1, d3t6dh2, d3t6dl_, d3t6dm_ automated match to d1prcc_ complexed with bcb, bpb, dga, fe2, gol, hec, hth, hto, lda, mq9, ns5, so4, uq9 |
PDB Entry: 3t6d (more details), 1.95 Å
SCOPe Domain Sequences for d3t6dc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t6dc_ a.138.1.2 (C:) automated matches {Blastochloris viridis [TaxId: 1079]} cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalpavkaegppvsqvyknvk vlgnlteaeflrtmtamtewvspeegctychdennlaseakypyvvarrmlemtraintn wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl gtnctfchnaqsfetwgkkstpqraiawwgirmvrdmnmnylaplntvlpasrlgrqgea pqadcrtchqgvtkplfgasrlqdypelgpikaa
Timeline for d3t6dc_:
View in 3D Domains from other chains: (mouse over for more information) d3t6dh1, d3t6dh2, d3t6dl_, d3t6dm_ |