Lineage for d3t5ga_ (3t5g A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (79 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein GTP-binding protein RheB [142275] (2 species) Species Human (Homo sapiens) [TaxId:9606] [142276] (3 PDB entries)
Uniprot Q15382 3-169
Domain d3t5ga_: 3t5g A: [185648]
Other proteins in same PDB: d3t5gb_
automated match to d1xtqa1
complexed with far, gdp, mg
Details for d3t5ga_
PDB Entry: 3t5g (more details), 1.7 Å
PDB Description: structure of fully modified farnesylated rheb in complex with pde6d
PDB Compounds: (A:) GTP-binding protein RhebSCOPe Domain Sequences for d3t5ga_:
Sequence, based on SEQRES records: (download)
>d3t5ga_ c.37.1.8 (A:) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]}
pqsksrkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvdt
agqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkk
dlhmervisyeegkalaeswnaaflessakenqtavdvfrriileaekmdgacsqgkssc
Sequence, based on observed residues (ATOM records): (download)
>d3t5ga_ c.37.1.8 (A:) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]}
pqsksrkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvdt
agqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvipimlvgnkkdlhm
ervisyeegkalaeswnaaflessakenqtavdvfrriileaekmqgkssc
SCOPe Domain Coordinates for d3t5ga_:
Click to download the PDB-style file with coordinates for d3t5ga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3t5ga_:
- d3t5ga_ first appeared in SCOPe 2.01
- d3t5ga_ appears in SCOPe 2.04
- d3t5ga_ appears in SCOPe 2.06
- d3t5ga_ appears in the current release, SCOPe 2.08
View in 3D
